SCOP 1.71: Domain d1f5ba_: 1f5b A:

Lineage for d1f5ba_ (1f5b A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families)

5. Family d.58.1.2: 7-Fe ferredoxin [54870] (2 proteins)
   has C-terminal extension to the common fold

6. Protein Ferredoxin [54871] (3 species)

7. Species Azotobacter vinelandii [TaxId:354] [54872] (32 PDB entries)

8. Domain d1f5ba_: 1f5b A: [38956]
   complexed with fs3, fs4; mutant

Details for d1f5ba_

PDB Entry: 1f5b, 1.62 Å

PDB Description: crystal structure of f2h ferredoxin 1 mutant from azotobacter vinelandii at 1.75 angstrom resolution

SCOP Domain Sequences for d1f5ba_:

Sequence; same for both SEQRES and ATOM records:

>d1f5ba_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii}
ahvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler

Timeline for d1f5ba_:

• d1f5ba_ first appeared (with stable ids) in SCOP 1.55
  
• d1f5ba_ appears in SCOP 1.69
  
• d1f5ba_ appears in SCOP 1.73
  
• d1f5ba_ appears in the current release, SCOPe 2.08