Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (19 species) not a true protein |
Species Dictyoglomus thermophilum [TaxId:309799] [389550] (1 PDB entry) |
Domain d6xxwa2: 6xxw A:174-264 [389551] Other proteins in same PDB: d6xxwa1, d6xxwa3 automated match to d3lpfa2 complexed with cl, mpd, trs |
PDB Entry: 6xxw (more details), 1.85 Å
SCOPe Domain Sequences for d6xxwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xxwa2 b.1.4.0 (A:174-264) automated matches {Dictyoglomus thermophilum [TaxId: 309799]} vyikdfsvitelsnnsalvkysiesegnnfqvilrdkdknivaenfgksgvlevknpklw epgnpylynleikllekdnfdiyrmdigirt
Timeline for d6xxwa2: