Lineage for d6xxwa2 (6xxw A:174-264)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763010Species Dictyoglomus thermophilum [TaxId:309799] [389550] (1 PDB entry)
  8. 2763011Domain d6xxwa2: 6xxw A:174-264 [389551]
    Other proteins in same PDB: d6xxwa1, d6xxwa3
    automated match to d3lpfa2
    complexed with cl, mpd, trs

Details for d6xxwa2

PDB Entry: 6xxw (more details), 1.85 Å

PDB Description: structure of beta-d-glucuronidase for dictyoglomus thermophilum.
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d6xxwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xxwa2 b.1.4.0 (A:174-264) automated matches {Dictyoglomus thermophilum [TaxId: 309799]}
vyikdfsvitelsnnsalvkysiesegnnfqvilrdkdknivaenfgksgvlevknpklw
epgnpylynleikllekdnfdiyrmdigirt

SCOPe Domain Coordinates for d6xxwa2:

Click to download the PDB-style file with coordinates for d6xxwa2.
(The format of our PDB-style files is described here.)

Timeline for d6xxwa2: