Class a: All alpha proteins [46456] (289 folds) |
Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily) core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices |
Superfamily a.190.1: Flavivirus capsid protein C [101257] (2 families) automatically mapped to Pfam PF01003 |
Family a.190.1.1: Flavivirus capsid protein C [101258] (1 protein) |
Protein Flavivirus capsid protein C [101259] (3 species) |
Species Dengue virus 2 [TaxId:11060] [389471] (2 PDB entries) |
Domain d6vsod_: 6vso D: [389547] automated match to d1r6ra_ complexed with gol, no3 |
PDB Entry: 6vso (more details), 3 Å
SCOPe Domain Sequences for d6vsod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vsod_ a.190.1.1 (D:) Flavivirus capsid protein C {Dengue virus 2 [TaxId: 11060]} rvstvqqltkrfslgmlqgrgplklfmalvaflrfltipptagilkrwgtikkskainvl rgfrkeigrmlnilnrrr
Timeline for d6vsod_: