Lineage for d6vsod_ (6vso D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349254Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily)
    core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices
  4. 2349255Superfamily a.190.1: Flavivirus capsid protein C [101257] (2 families) (S)
    automatically mapped to Pfam PF01003
  5. 2349256Family a.190.1.1: Flavivirus capsid protein C [101258] (1 protein)
  6. 2349257Protein Flavivirus capsid protein C [101259] (3 species)
  7. 2349258Species Dengue virus 2 [TaxId:11060] [389471] (2 PDB entries)
  8. 2349264Domain d6vsod_: 6vso D: [389547]
    automated match to d1r6ra_
    complexed with gol, no3

Details for d6vsod_

PDB Entry: 6vso (more details), 3 Å

PDB Description: denguev-2 capsid structure
PDB Compounds: (D:) Capsid premembrane protein

SCOPe Domain Sequences for d6vsod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vsod_ a.190.1.1 (D:) Flavivirus capsid protein C {Dengue virus 2 [TaxId: 11060]}
rvstvqqltkrfslgmlqgrgplklfmalvaflrfltipptagilkrwgtikkskainvl
rgfrkeigrmlnilnrrr

SCOPe Domain Coordinates for d6vsod_:

Click to download the PDB-style file with coordinates for d6vsod_.
(The format of our PDB-style files is described here.)

Timeline for d6vsod_: