Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6vn1i_: 6vn1 I: [389516] Other proteins in same PDB: d6vn1a_, d6vn1b_, d6vn1c_, d6vn1l_, d6vn1m_, d6vn1n_ automated match to d5c2bh_ |
PDB Entry: 6vn1 (more details), 2.8 Å
SCOPe Domain Sequences for d6vn1i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vn1i_ b.1.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvqlvqsgaevkkpgssvkvsckasggtfsnfaiswvrqapgqglewmgrimplfvtsty aqkfqgrvtisadaststaymelsslrsddtamyycarditapgaaptplnfygmdvwgq gttvtvss
Timeline for d6vn1i_: