SCOP 1.73: Domain d5fd1a_: 5fd1 A:

Lineage for d5fd1a_ (5fd1 A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families)

5. Family d.58.1.2: 7-Fe ferredoxin [54870] (2 proteins)
   has C-terminal extension to the common fold

6. Protein Ferredoxin [54871] (3 species)

7. Species Azotobacter vinelandii [TaxId:354] [54872] (32 PDB entries)

8. Domain d5fd1a_: 5fd1 A: [38950]
   complexed with fs3, fs4

Details for d5fd1a_

PDB Entry: 5fd1, 1.9 Å

PDB Description: crystal structures of oxidized and reduced azotobacter vinelandii ferredoxin at ph 8 and ph 6

PDB Compounds: (A:) ferredoxin

SCOP Domain Sequences for d5fd1a_:

Sequence; same for both SEQRES and ATOM records:

>d5fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]}
afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler

Timeline for d5fd1a_:

• d5fd1a_ first appeared (with stable ids) in SCOP 1.55, called d5fd1__
  
• d5fd1a_ was called d5fd1__ in SCOP 1.71
  
• d5fd1a_ appears in SCOP 1.75
  
• d5fd1a_ appears in the current release, SCOPe 2.08