Lineage for d6utle_ (6utl E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879136Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187694] (14 PDB entries)
  8. 2879155Domain d6utle_: 6utl E: [389489]
    automated match to d3sbca_
    mutant

Details for d6utle_

PDB Entry: 6utl (more details), 2.6 Å

PDB Description: yeast thiol specific antoxidant 2 with c171s mutation and catalytic cysteine alkylated with iodoacetamide
PDB Compounds: (E:) Peroxiredoxin TSA2

SCOPe Domain Sequences for d6utle_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6utle_ c.47.1.0 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaevqkqappfkktavvdgifeeislekykgkyvvlafvplafsfvcpteivafsdaakk
fedqgaqvlfastdseysllawtnlprkdgglgpvkvplladknhslsrdygvliekegi
alrglfiidpkgiirhitindlsvgrnvnealrlvegfqwtdkn

SCOPe Domain Coordinates for d6utle_:

Click to download the PDB-style file with coordinates for d6utle_.
(The format of our PDB-style files is described here.)

Timeline for d6utle_: