Lineage for d1clfa_ (1clf A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2192664Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2192665Family d.58.1.1: Short-chain ferredoxins [54863] (2 proteins)
    contains two 4Fe-4S clusters
  6. 2192666Protein Ferredoxin II [54864] (5 species)
  7. 2192673Species Clostridium pasteurianum [TaxId:1501] [54868] (1 PDB entry)
  8. 2192674Domain d1clfa_: 1clf A: [38947]
    complexed with sf4

Details for d1clfa_

PDB Entry: 1clf (more details)

PDB Description: clostridium pasteurianum ferredoxin
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d1clfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clfa_ d.58.1.1 (A:) Ferredoxin II {Clostridium pasteurianum [TaxId: 1501]}
aykiadscvscgacasecpvnaisqgdsifvidadtcidcgncanvcpvgapvqe

SCOPe Domain Coordinates for d1clfa_:

Click to download the PDB-style file with coordinates for d1clfa_.
(The format of our PDB-style files is described here.)

Timeline for d1clfa_: