SCOPe 2.08: Domain d6umza1: 6umz A:1-125

Lineage for d6umza1 (6umz A:1-125)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (3 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (84 PDB entries)
   Uniprot P16113

8. Domain d6umza1: 6umz A:1-125 [389464]
   Other proteins in same PDB: d6umza2
   automated match to d1nwza_
   complexed with qbv

Details for d6umza1

PDB Entry: 6umz, 0.9 Å

PDB Description: crystal structure of photoactive yellow protein (pyp); 3-br-p-coumaric acid chromophore

PDB Compounds: (A:) Photoactive yellow protein

SCOPe Domain Sequences for d6umza1:

Sequence; same for both SEQRES and ATOM records:

>d6umza1 d.110.3.1 (A:1-125) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

Timeline for d6umza1:

• d6umza1 first appeared in SCOPe 2.07