Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein Green fluorescent protein, GFP [54513] (6 species) |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries) Uniprot P42212 |
Domain d6un4a1: 6un4 A:3-239 [389430] Other proteins in same PDB: d6un4a2 automated match to d3srya_ complexed with 3ct, ohd, so4 |
PDB Entry: 6un4 (more details), 1.5 Å
SCOPe Domain Sequences for d6un4a1:
Sequence, based on SEQRES records: (download)
>d6un4a1 d.22.1.1 (A:3-239) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]} skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv ttlxvlcfsrypdhmkqhdffksampegyvqertiffkddgnxktraevkfegdtlvnri elkgidfkedgnilghkleynynshnvyimadkqkngiksnfkirhniedgsvqladhyq qntpigdgpvllpdnhylstqsklskdpnekrdhmvllefvtaagitlgmdelyk
>d6un4a1 d.22.1.1 (A:3-239) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]} skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv ttlxvlcfsrypdhmkqhdffksampegyvqertiffkddgnktraevkfegdtlvnrie lkgidfkedgnilghkleynynshnvyimadkqkngiksnfkirhniedgsvqladhyqq ntpigdgpvllpdnhylstqsklskdpnekrdhmvllefvtaagitlgmdelyk
Timeline for d6un4a1: