Lineage for d1dura_ (1dur A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1650134Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1650135Family d.58.1.1: Short-chain ferredoxins [54863] (2 proteins)
    contains two 4Fe-4S clusters
  6. 1650136Protein Ferredoxin II [54864] (5 species)
  7. 1650145Species Peptostreptococcus asaccharolyticus [TaxId:1258] [54866] (1 PDB entry)
  8. 1650146Domain d1dura_: 1dur A: [38943]
    complexed with sf4

Details for d1dura_

PDB Entry: 1dur (more details), 2 Å

PDB Description: replacement for 1fdx 2(4fe4s) ferredoxin from (now) peptostreptococcus asaccharolyticus
PDB Compounds: (A:) 2[4fe-4s] ferredoxin

SCOPe Domain Sequences for d1dura_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]}
ayvindsciacgackpecpvnciqegsiyaidadscidcgscasvcpvgapnped

SCOPe Domain Coordinates for d1dura_:

Click to download the PDB-style file with coordinates for d1dura_.
(The format of our PDB-style files is described here.)

Timeline for d1dura_: