Lineage for d1dura_ (1dur A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.58: Ferredoxin-like [54861] (40 superfamilies) Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) 
Family d.58.1.1: Short-chain ferredoxins [54863] (1 protein) Protein Ferredoxin II [54864] (5 species) 
Species Peptostreptococcus asaccharolyticus [TaxId:1258] [54866] (1 PDB entry) 
Domain d1dura_: 1dur A: [38943]
Details for d1dura_
PDB Entry: 1dur (more details), 2 Å
PDB Description: replacement for 1fdx 2(4fe4s) ferredoxin from (now) peptostreptococcus asaccharolyticus
SCOP Domain Sequences for d1dura_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus}
ayvindsciacgackpecpvnciqegsiyaidadscidcgscasvcpvgapnped
SCOP Domain Coordinates for d1dura_:
Click to download the PDB-style file with coordinates for d1dura_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dura_:
- d1dura_ first appeared (with stable ids) in SCOP 1.55
- d1dura_ appears in SCOP 1.59
- d1dura_ appears in SCOP 1.63
- d1dura_ appears in the current release, SCOPe 2.08
View in 3D