Lineage for d1dura_ (1dur A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133320Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 133321Family d.58.1.1: Short-chain ferredoxins [54863] (1 protein)
  6. 133322Protein Ferredoxin II [54864] (5 species)
  7. 133334Species Peptostreptococcus asaccharolyticus [TaxId:1258] [54866] (1 PDB entry)
  8. 133335Domain d1dura_: 1dur A: [38943]

Details for d1dura_

PDB Entry: 1dur (more details), 2 Å

PDB Description: replacement for 1fdx 2(4fe4s) ferredoxin from (now) peptostreptococcus asaccharolyticus

SCOP Domain Sequences for d1dura_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus}
ayvindsciacgackpecpvnciqegsiyaidadscidcgscasvcpvgapnped

SCOP Domain Coordinates for d1dura_:

Click to download the PDB-style file with coordinates for d1dura_.
(The format of our PDB-style files is described here.)

Timeline for d1dura_: