![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) ![]() |
![]() | Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins) contains only one 4Fe-4S cluster |
![]() | Protein Ferredoxin I [54880] (2 species) |
![]() | Species Desulfovibrio gigas [TaxId:879] [54865] (2 PDB entries) |
![]() | Domain d1fxda_: 1fxd A: [38941] complexed with f3s |
PDB Entry: 1fxd (more details), 1.7 Å
SCOPe Domain Sequences for d1fxda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} pievnddcmaceacveicpdvfemneegdkavvinpdsdldcveeaidscpaeaivrs
Timeline for d1fxda_: