![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) ![]() |
![]() | Family d.58.1.1: Short-chain ferredoxins [54863] (1 protein) |
![]() | Protein Ferredoxin II [54864] (5 species) |
![]() | Species Desulfovibrio gigas [TaxId:879] [54865] (2 PDB entries) |
![]() | Domain d1fxd__: 1fxd - [38941] |
PDB Entry: 1fxd (more details), 1.7 Å
SCOP Domain Sequences for d1fxd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fxd__ d.58.1.1 (-) Ferredoxin II {Desulfovibrio gigas} pievnddcmaceacveicpdvfemneegdkavvinpdsdldcveeaidscpaeaivrs
Timeline for d1fxd__: