Lineage for d6rxbd1 (6rxb D:4-67)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2306149Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2306150Protein automated matches [190674] (25 species)
    not a true protein
  7. 2306151Species Acinetobacter baumannii [TaxId:509173] [389356] (1 PDB entry)
  8. 2306155Domain d6rxbd1: 6rxb D:4-67 [389409]
    Other proteins in same PDB: d6rxba2, d6rxbb2, d6rxbb3, d6rxbc2, d6rxbd2, d6rxbd3
    automated match to d2ns7a1
    complexed with cl, edo, mg, miy, sin

Details for d6rxbd1

PDB Entry: 6rxb (more details), 2.25 Å

PDB Description: crystal structure of tetr-q116a from acinetobacter baumannii aye in complex with minocycline
PDB Compounds: (D:) Tetracycline repressor protein class G

SCOPe Domain Sequences for d6rxbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rxbd1 a.4.1.0 (D:4-67) automated matches {Acinetobacter baumannii [TaxId: 509173]}
ldkgtviaaalellnevgmdslttrklaerlkvqqpalywhfqnkralldalaeamlaer
htrs

SCOPe Domain Coordinates for d6rxbd1:

Click to download the PDB-style file with coordinates for d6rxbd1.
(The format of our PDB-style files is described here.)

Timeline for d6rxbd1: