SCOPe 2.07: Domain d6tb1b1: 6tb1 B:6-455

Lineage for d6tb1b1 (6tb1 B:6-455)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Pseudomonas sp. [TaxId:306] [315480] (7 PDB entries)

8. Domain d6tb1b1: 6tb1 B:6-455 [389405]
   Other proteins in same PDB: d6tb1a2, d6tb1b2
   automated match to d4ah3a_
   complexed with gol, na, plp, sin; mutant

Details for d6tb1b1

PDB Entry: 6tb1, 1.85 Å

PDB Description: crystal structure of thermostable omega transaminase 6-fold mutant from pseudomonas jessenii

PDB Compounds: (B:) Aspartate aminotransferase family protein

SCOPe Domain Sequences for d6tb1b1:

Sequence; same for both SEQRES and ATOM records:

>d6tb1b1 c.67.1.0 (B:6-455) automated matches {Pseudomonas sp. [TaxId: 306]}
sslaekdiqyqlhpytnarlhqelgpliiergqgiyvyddqgkgyieamaglwsvalgfs
nqrlikaaeqqfntlpfyhlfnhkshrpsielaekliemapvpmskvfftnsgseandtv
vkfvwylnnalgkpakkkfisrvngyhgvtvasasltglpgnqrgfdlplpgflhvgcph
hyrfalageseehfadrlaveleqkilaegpetiaafigeplmgaggvivpprtywekiq
kvcrkydilviadevicgfgrtgqmfgsqtfgiqpdimvlskqlsssyqpiaailinapv
fegiadqsqalgalghgftgsghpvatavalenlkiieeeslvehaaqmgqllrsglqhf
idhplvgeirgcgliaavelvgdrvskapyqalgtlgrymagraqehgmitramgdavaf
cpplivneqevgmiverfaralddttqwvg

Timeline for d6tb1b1:

• d6tb1b1 is new in SCOPe 2.07-stable
  
• d6tb1b1 appears in the current release, SCOPe 2.08