Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily) 3-helical bundle packed against 3-stranded mixed beta-sheet |
Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) |
Family d.56.1.2: Group II chaperonin (CCT, TRIC), intermediate domain [54853] (1 protein) |
Protein Thermosome, I domain [54854] (3 species) |
Species Thermoplasma acidophilum, beta chain [TaxId:2303] [100974] (2 PDB entries) |
Domain d1a6eb3: 1a6e B:145-215,B:368-403 [38939] Other proteins in same PDB: d1a6ea1, d1a6ea2, d1a6eb1, d1a6eb2 complexed with adp, af3, mg |
PDB Entry: 1a6e (more details), 3.2 Å
SCOPe Domain Sequences for d1a6eb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6eb3 d.56.1.2 (B:145-215,B:368-403) Thermosome, I domain {Thermoplasma acidophilum, beta chain [TaxId: 2303]} gadekalllkmaqtslnsksasvakdklaeisyeavksvaelrdgkyyvdfdniqvvkkq ggaiddtqlinXkavsilvrgetehvvdemersitdslhvvasaledg
Timeline for d1a6eb3: