Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.56: GroEL-like chaperone, intermediate domain [54848] (1 superfamily) |
Superfamily d.56.1: GroEL-like chaperone, intermediate domain [54849] (2 families) |
Family d.56.1.2: Group II chaperonin (CCT, TRIC) [54853] (1 protein) |
Protein Thermosome [54854] (1 species) |
Species Thermoplasma acidophilum [TaxId:2303] [54855] (2 PDB entries) |
Domain d1a6eb3: 1a6e B:145-215,B:368-403 [38939] Other proteins in same PDB: d1a6ea1, d1a6ea2, d1a6eb1, d1a6eb2 |
PDB Entry: 1a6e (more details), 3.2 Å
SCOP Domain Sequences for d1a6eb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6eb3 d.56.1.2 (B:145-215,B:368-403) Thermosome {Thermoplasma acidophilum} gadekalllkmaqtslnsksasvakdklaeisyeavksvaelrdgkyyvdfdniqvvkkq ggaiddtqlinXkavsilvrgetehvvdemersitdslhvvasaledg
Timeline for d1a6eb3: