SCOPe 2.05: Domain d1a6db3: 1a6d B:145-215,B:368-403

Lineage for d1a6db3 (1a6d B:145-215,B:368-403)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
   3-helical bundle packed against 3-stranded mixed beta-sheet

4. Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families)

5. Family d.56.1.2: Group II chaperonin (CCT, TRIC), intermediate domain [54853] (1 protein)

6. Protein Thermosome, I domain [54854] (3 species)

7. Species Thermoplasma acidophilum, beta chain [TaxId:2303] [100974] (2 PDB entries)

8. Domain d1a6db3: 1a6d B:145-215,B:368-403 [38937]
   Other proteins in same PDB: d1a6da1, d1a6da2, d1a6db1, d1a6db2

Details for d1a6db3

PDB Entry: 1a6d, 2.6 Å

PDB Description: thermosome from t. acidophilum

PDB Compounds: (B:) thermosome (beta subunit)

SCOPe Domain Sequences for d1a6db3:

Sequence; same for both SEQRES and ATOM records:

>d1a6db3 d.56.1.2 (B:145-215,B:368-403) Thermosome, I domain {Thermoplasma acidophilum, beta chain [TaxId: 2303]}
gadekalllkmaqtslnsksasvakdklaeisyeavksvaelrdgkyyvdfdniqvvkkq
ggaiddtqlinXkavsilvrgetehvvdemersitdslhvvasaledg

Timeline for d1a6db3:

• d1a6db3 first appeared (with stable ids) in SCOP 1.55
  
• d1a6db3 appears in SCOPe 2.04
  
• d1a6db3 appears in SCOPe 2.06
  
• d1a6db3 appears in the current release, SCOPe 2.08