Lineage for d1a6db3 (1a6d B:145-215,B:368-403)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79950Fold d.56: GroEL-like chaperone, intermediate domain [54848] (1 superfamily)
  4. 79951Superfamily d.56.1: GroEL-like chaperone, intermediate domain [54849] (2 families) (S)
  5. 79991Family d.56.1.2: Group II chaperonin (CCT, TRIC) [54853] (1 protein)
  6. 79992Protein Thermosome [54854] (1 species)
  7. 79993Species Archaeon Thermoplasma acidophilum [TaxId:2303] [54855] (2 PDB entries)
  8. 79995Domain d1a6db3: 1a6d B:145-215,B:368-403 [38937]
    Other proteins in same PDB: d1a6da1, d1a6da2, d1a6db1, d1a6db2

Details for d1a6db3

PDB Entry: 1a6d (more details), 2.6 Å

PDB Description: thermosome from t. acidophilum

SCOP Domain Sequences for d1a6db3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6db3 d.56.1.2 (B:145-215,B:368-403) Thermosome {Archaeon Thermoplasma acidophilum}
gadekalllkmaqtslnsksasvakdklaeisyeavksvaelrdgkyyvdfdniqvvkkq
ggaiddtqlinXkavsilvrgetehvvdemersitdslhvvasaledg

SCOP Domain Coordinates for d1a6db3:

Click to download the PDB-style file with coordinates for d1a6db3.
(The format of our PDB-style files is described here.)

Timeline for d1a6db3: