Lineage for d1grla3 (1grl A:137-190,A:367-409)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723181Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 723182Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 723183Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 723184Protein GroEL, I domain [54851] (4 species)
  7. 723185Species Escherichia coli [TaxId:562] [54852] (9 PDB entries)
  8. 723263Domain d1grla3: 1grl A:137-190,A:367-409 [38935]
    Other proteins in same PDB: d1grla1, d1grla2, d1grlb1, d1grlb2, d1grlc1, d1grlc2, d1grld1, d1grld2, d1grle1, d1grle2, d1grlf1, d1grlf2, d1grlg1, d1grlg2
    mutant

Details for d1grla3

PDB Entry: 1grl (more details), 2.8 Å

PDB Description: the crystal structure of the bacterial chaperonin groel at 2.8 angstroms
PDB Compounds: (A:) groEL (hsp60 class)

SCOP Domain Sequences for d1grla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grla3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOP Domain Coordinates for d1grla3:

Click to download the PDB-style file with coordinates for d1grla3.
(The format of our PDB-style files is described here.)

Timeline for d1grla3: