Lineage for d1grl_3 (1grl 137-190,367-409)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603057Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 603058Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 603059Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 603060Protein GroEL, I domain [54851] (4 species)
  7. 603061Species Escherichia coli [TaxId:562] [54852] (9 PDB entries)
  8. 603167Domain d1grl_3: 1grl 137-190,367-409 [38935]
    Other proteins in same PDB: d1grl_1, d1grl_2
    mutant

Details for d1grl_3

PDB Entry: 1grl (more details), 2.8 Å

PDB Description: the crystal structure of the bacterial chaperonin groel at 2.8 angstroms

SCOP Domain Sequences for d1grl_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grl_3 d.56.1.1 (137-190,367-409) GroEL, I domain {Escherichia coli}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOP Domain Coordinates for d1grl_3:

Click to download the PDB-style file with coordinates for d1grl_3.
(The format of our PDB-style files is described here.)

Timeline for d1grl_3: