Lineage for d1aonn3 (1aon N:137-190,N:367-409)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133257Fold d.56: GroEL-like chaperone, intermediate domain [54848] (1 superfamily)
  4. 133258Superfamily d.56.1: GroEL-like chaperone, intermediate domain [54849] (2 families) (S)
  5. 133259Family d.56.1.1: GroEL [54850] (1 protein)
  6. 133260Protein GroEL [54851] (2 species)
  7. 133261Species Escherichia coli [TaxId:562] [54852] (4 PDB entries)
  8. 133296Domain d1aonn3: 1aon N:137-190,N:367-409 [38934]
    Other proteins in same PDB: d1aona1, d1aona2, d1aonb1, d1aonb2, d1aonc1, d1aonc2, d1aond1, d1aond2, d1aone1, d1aone2, d1aonf1, d1aonf2, d1aong1, d1aong2, d1aonh1, d1aonh2, d1aoni1, d1aoni2, d1aonj1, d1aonj2, d1aonk1, d1aonk2, d1aonl1, d1aonl2, d1aonm1, d1aonm2, d1aonn1, d1aonn2, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_

Details for d1aonn3

PDB Entry: 1aon (more details), 3 Å

PDB Description: crystal structure of the asymmetric chaperonin complex groel/groes/(adp)7

SCOP Domain Sequences for d1aonn3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aonn3 d.56.1.1 (N:137-190,N:367-409) GroEL {Escherichia coli}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOP Domain Coordinates for d1aonn3:

Click to download the PDB-style file with coordinates for d1aonn3.
(The format of our PDB-style files is described here.)

Timeline for d1aonn3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aona1, d1aona2, d1aona3, d1aonb1, d1aonb2, d1aonb3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonj1, d1aonj2, d1aonj3, d1aonk1, d1aonk2, d1aonk3, d1aonl1, d1aonl2, d1aonl3, d1aonm1, d1aonm2, d1aonm3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_