SCOPe 2.08: Domain d6kfya1: 6kfy A:1-406

Lineage for d6kfya1 (6kfy A:1-406)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (166 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [320074] (13 PDB entries)

8. Domain d6kfya1: 6kfy A:1-406 [389323]
   Other proteins in same PDB: d6kfya2
   automated match to d5ft6a_
   complexed with peg, pge, so4

Details for d6kfya1

PDB Entry: 6kfy, 1.97 Å

PDB Description: sufs from bacillus subtilis in a resting state at 1.96 angstrom resolution

PDB Compounds: (A:) Cysteine desulfurase SufS

SCOPe Domain Sequences for d6kfya1:

Sequence; same for both SEQRES and ATOM records:

>d6kfya1 c.67.1.0 (A:1-406) automated matches {Bacillus subtilis [TaxId: 224308]}
mnitdireqfpilhqqvnghdlvyldsaatsqkpravietldkyynqynsnvhrgvhtlg
tratdgyegarekvrkfinaksmaeiiftkgtttslnmvalsyaranlkpgdevvityme
hhaniipwqqavkatgatlkyiplqedgtisledvretvtsntkivavshvsnvlgtvnp
ikemakiahdngavivvdgaqstphmkidvqdldcdffalsshkmcgptgvgvlygkkal
lenmepaefggemidfvglyestwkelpwkfeagtpiiagaiglgaaidfleeigldeis
rhehklaayalerfrqldgvtvygpeeraglvtfnlddvhphdvatvldaegiavraghh
caqplmkwldvtatarasfylynteeeidklvealqktkeyftnvf

Timeline for d6kfya1:

• d6kfya1 first appeared in SCOPe 2.07