Lineage for d6kfya1 (6kfy A:1-406)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2896809Species Bacillus subtilis [TaxId:224308] [320074] (13 PDB entries)
  8. 2896811Domain d6kfya1: 6kfy A:1-406 [389323]
    Other proteins in same PDB: d6kfya2
    automated match to d5ft6a_
    complexed with peg, pge, so4

Details for d6kfya1

PDB Entry: 6kfy (more details), 1.97 Å

PDB Description: sufs from bacillus subtilis in a resting state at 1.96 angstrom resolution
PDB Compounds: (A:) Cysteine desulfurase SufS

SCOPe Domain Sequences for d6kfya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kfya1 c.67.1.0 (A:1-406) automated matches {Bacillus subtilis [TaxId: 224308]}
mnitdireqfpilhqqvnghdlvyldsaatsqkpravietldkyynqynsnvhrgvhtlg
tratdgyegarekvrkfinaksmaeiiftkgtttslnmvalsyaranlkpgdevvityme
hhaniipwqqavkatgatlkyiplqedgtisledvretvtsntkivavshvsnvlgtvnp
ikemakiahdngavivvdgaqstphmkidvqdldcdffalsshkmcgptgvgvlygkkal
lenmepaefggemidfvglyestwkelpwkfeagtpiiagaiglgaaidfleeigldeis
rhehklaayalerfrqldgvtvygpeeraglvtfnlddvhphdvatvldaegiavraghh
caqplmkwldvtatarasfylynteeeidklvealqktkeyftnvf

SCOPe Domain Coordinates for d6kfya1:

Click to download the PDB-style file with coordinates for d6kfya1.
(The format of our PDB-style files is described here.)

Timeline for d6kfya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6kfya2