SCOPe 2.08: Domain d6lfba1: 6lfb A:2-179

Lineage for d6lfba1 (6lfb A:2-179)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.5: TAP-like [89594] (3 proteins)
   automatically mapped to Pfam PF00657
   automatically mapped to Pfam PF13472

6. Protein automated matches [333488] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [333489] (6 PDB entries)

8. Domain d6lfba1: 6lfb A:2-179 [389256]
   Other proteins in same PDB: d6lfba2
   automated match to d1ivna_
   mutant

Details for d6lfba1

PDB Entry: 6lfb, 1.99 Å

PDB Description: e. coli thioesterase i mutant dg

PDB Compounds: (A:) Acyl-CoA thioesterase I also functions as protease I

SCOPe Domain Sequences for d6lfba1:

Sequence; same for both SEQRES and ATOM records:

>d6lfba1 c.23.10.5 (A:2-179) automated matches {Escherichia coli [TaxId: 562]}
dtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkqh
qprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrryneaf
saiypklakefdvpllpffmdevglkpqwmqddgihpnrdaqpfiadwmakqlqplvn

Timeline for d6lfba1:

• d6lfba1 first appeared in SCOPe 2.07