SCOPe 2.07: Domain d6tj8a2: 6tj8 A:333-527

Lineage for d6tj8a2 (6tj8 A:333-527)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [324640] (4 PDB entries)

8. Domain d6tj8a2: 6tj8 A:333-527 [389161]
   Other proteins in same PDB: d6tj8a1, d6tj8a3, d6tj8a4, d6tj8b1, d6tj8b3, d6tj8b4
   automated match to d1qgda1
   complexed with ca, edo, ndq

Details for d6tj8a2

PDB Entry: 6tj8, 0.92 Å

PDB Description: escherichia coli transketolase in complex with cofactor analog 2'- methoxythiamine diphosphate

PDB Compounds: (A:) Transketolase 1

SCOPe Domain Sequences for d6tj8a2:

Sequence; same for both SEQRES and ATOM records:

>d6tj8a2 c.36.1.0 (A:333-527) automated matches {Escherichia coli [TaxId: 83333]}
mpsdfdakakefiaklqanpakiasrkasqnaieafgpllpeflggsadlapsnltlwsg
skainedaagnyihygvrefgmtaiangislhggflpytstflmfveyarnavrmaalmk
qrqvmvythdsiglgedgpthqpveqvaslrvtpnmstwrpcdqvesavawkygverqdg
ptalilsrqnlaqqe

Timeline for d6tj8a2:

• d6tj8a2 is new in SCOPe 2.07-stable
  
• d6tj8a2 appears in the current release, SCOPe 2.08