SCOPe 2.08: Domain d6xgsb1: 6xgs B:1-293

Lineage for d6xgsb1 (6xgs B:1-293)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (94 species)
   not a true protein

7. Species Brucella suis [TaxId:204722] [389085] (1 PDB entry)

8. Domain d6xgsb1: 6xgs B:1-293 [389136]
   Other proteins in same PDB: d6xgsa2, d6xgsb2, d6xgsc2, d6xgsd2
   automated match to d4i7ua_
   complexed with cit, po4

Details for d6xgsb1

PDB Entry: 6xgs, 2.2 Å

PDB Description: crystal structure of dihydrodipicolinate synthase (dhdps) from brucella suis 1330

PDB Compounds: (B:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d6xgsb1:

Sequence; same for both SEQRES and ATOM records:

>d6xgsb1 c.1.10.0 (B:1-293) automated matches {Brucella suis [TaxId: 204722]}
mlkgsitalvtpfdregafdekafrafvnwqieegtkglvpvgttgetptlshdehkrvi
evcievaagrvpviagagsnntveaielaqhaekagadavlvvtpyynkpnqrglyehfs
rvvrsisiplviynipgrsiidmtpetmgalvrdcknivgvkdatgkiervseqraicgk
efiqlsgedatalgfnahggvgcisvtsniaprlcaefqeacqagnfakalelqdrlmpl
hkalflepnpsgpkyalsrlgrienvlrspmvtieaataekidhamkhaglin

Timeline for d6xgsb1:

• d6xgsb1 first appeared in SCOPe 2.07