SCOPe 2.08: Domain d6y3ba_: 6y3b A:

Lineage for d6y3ba_ (6y3b A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)

4. Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families)
   Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex

5. Family g.96.1.0: automated matches [324385] (1 protein)
   not a true family

6. Protein automated matches [324386] (3 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [327137] (14 PDB entries)

8. Domain d6y3ba_: 6y3b A: [389121]
   Other proteins in same PDB: d6y3bb_
   automated match to d2ggva_
   complexed with gol, o7n, so4

Details for d6y3ba_

PDB Entry: 6y3b, 1.59 Å

PDB Description: crystal structure of unlinked ns2b-ns3 protease from zika virus in complex with inhibitor mi-2110

PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d6y3ba_:

Sequence; same for both SEQRES and ATOM records:

>d6y3ba_ g.96.1.0 (A:) automated matches {Zika virus [TaxId: 64320]}
dmyieragditwekdaevtgnsprldvaldesgdfslv

Timeline for d6y3ba_:

• d6y3ba_ first appeared in SCOPe 2.07