Lineage for d6y3bb_ (6y3b B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797067Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2797157Protein automated matches [190658] (12 species)
    not a true protein
  7. 2797286Species Zika virus [TaxId:64320] [327129] (7 PDB entries)
  8. 2797287Domain d6y3bb_: 6y3b B: [389104]
    Other proteins in same PDB: d6y3ba_
    automated match to d3e90b_
    complexed with gol, o7n, so4

Details for d6y3bb_

PDB Entry: 6y3b (more details), 1.59 Å

PDB Description: crystal structure of unlinked ns2b-ns3 protease from zika virus in complex with inhibitor mi-2110
PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d6y3bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y3bb_ b.47.1.3 (B:) automated matches {Zika virus [TaxId: 64320]}
ttdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdlv
sycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsgs
pildkcgrviglygngvvikngsyvsaitqgkreeetpv

SCOPe Domain Coordinates for d6y3bb_:

Click to download the PDB-style file with coordinates for d6y3bb_.
(The format of our PDB-style files is described here.)

Timeline for d6y3bb_: