SCOPe 2.08: Domain d6y3bb_: 6y3b B:

Lineage for d6y3bb_ (6y3b B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (12 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [327129] (7 PDB entries)

8. Domain d6y3bb_: 6y3b B: [389104]
   Other proteins in same PDB: d6y3ba_
   automated match to d3e90b_
   complexed with gol, o7n, so4

Details for d6y3bb_

PDB Entry: 6y3b, 1.59 Å

PDB Description: crystal structure of unlinked ns2b-ns3 protease from zika virus in complex with inhibitor mi-2110

PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d6y3bb_:

Sequence; same for both SEQRES and ATOM records:

>d6y3bb_ b.47.1.3 (B:) automated matches {Zika virus [TaxId: 64320]}
ttdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdlv
sycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsgs
pildkcgrviglygngvvikngsyvsaitqgkreeetpv

Timeline for d6y3bb_:

• d6y3bb_ first appeared in SCOPe 2.07