Lineage for d6wf6a_ (6wf6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942879Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2942880Protein automated matches [190239] (26 species)
    not a true protein
  7. 2943064Species Streptomyces coelicolor [TaxId:100226] [388740] (9 PDB entries)
  8. 2943066Domain d6wf6a_: 6wf6 A: [389094]
    automated match to d1jc5b_
    complexed with co, peg

Details for d6wf6a_

PDB Entry: 6wf6 (more details), 1.39 Å

PDB Description: streptomyces coelicolor methylmalonyl-coa epimerase
PDB Compounds: (A:) Methylmalonyl-CoA Epimerase

SCOPe Domain Sequences for d6wf6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wf6a_ d.32.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
sltridhigiachdldatvefyratygfevfhtevneeqgvreamlkindtsdggasylq
lleptredsavgkwlakngegvhhiafgtadvdadaadirdkgvrvlydeprrgsmgsri
tflhpkdchgvltelvtsaav

SCOPe Domain Coordinates for d6wf6a_:

Click to download the PDB-style file with coordinates for d6wf6a_.
(The format of our PDB-style files is described here.)

Timeline for d6wf6a_: