SCOPe 2.08: Domain d6wf6a_: 6wf6 A:

Lineage for d6wf6a_ (6wf6 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:100226] [388740] (9 PDB entries)

8. Domain d6wf6a_: 6wf6 A: [389094]
   automated match to d1jc5b_
   complexed with co, peg

Details for d6wf6a_

PDB Entry: 6wf6, 1.39 Å

PDB Description: streptomyces coelicolor methylmalonyl-coa epimerase

PDB Compounds: (A:) Methylmalonyl-CoA Epimerase

SCOPe Domain Sequences for d6wf6a_:

Sequence; same for both SEQRES and ATOM records:

>d6wf6a_ d.32.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
sltridhigiachdldatvefyratygfevfhtevneeqgvreamlkindtsdggasylq
lleptredsavgkwlakngegvhhiafgtadvdadaadirdkgvrvlydeprrgsmgsri
tflhpkdchgvltelvtsaav

Timeline for d6wf6a_:

• d6wf6a_ first appeared in SCOPe 2.07