Lineage for d1derb3 (1der B:137-190,B:367-409)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133257Fold d.56: GroEL-like chaperone, intermediate domain [54848] (1 superfamily)
  4. 133258Superfamily d.56.1: GroEL-like chaperone, intermediate domain [54849] (2 families) (S)
  5. 133259Family d.56.1.1: GroEL [54850] (1 protein)
  6. 133260Protein GroEL [54851] (2 species)
  7. 133261Species Escherichia coli [TaxId:562] [54852] (4 PDB entries)
  8. 133270Domain d1derb3: 1der B:137-190,B:367-409 [38908]
    Other proteins in same PDB: d1dera1, d1dera2, d1derb1, d1derb2, d1derc1, d1derc2, d1derd1, d1derd2, d1dere1, d1dere2, d1derf1, d1derf2, d1derg1, d1derg2, d1derh1, d1derh2, d1deri1, d1deri2, d1derj1, d1derj2, d1derk1, d1derk2, d1derl1, d1derl2, d1derm1, d1derm2, d1dern1, d1dern2

Details for d1derb3

PDB Entry: 1der (more details), 2.4 Å

PDB Description: the 2.4 angstrom crystal structure of the bacterial chaperonin groel complexed with atp-gamma-s

SCOP Domain Sequences for d1derb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1derb3 d.56.1.1 (B:137-190,B:367-409) GroEL {Escherichia coli}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOP Domain Coordinates for d1derb3:

Click to download the PDB-style file with coordinates for d1derb3.
(The format of our PDB-style files is described here.)

Timeline for d1derb3: