Lineage for d6ts4a_ (6ts4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795278Protein Coagulation factor XI [117237] (1 species)
  7. 2795279Species Human (Homo sapiens) [TaxId:9606] [117238] (59 PDB entries)
    Uniprot P03951 388-624
  8. 2795280Domain d6ts4a_: 6ts4 A: [389068]
    automated match to d3bg8a_
    complexed with dms, j7b, na, so4

Details for d6ts4a_

PDB Entry: 6ts4 (more details), 1.17 Å

PDB Description: coagulation factor xi protease domain in complex with active site inhibitor
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d6ts4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ts4a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpislpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdaggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektq

SCOPe Domain Coordinates for d6ts4a_:

Click to download the PDB-style file with coordinates for d6ts4a_.
(The format of our PDB-style files is described here.)

Timeline for d6ts4a_: