Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (26 species) not a true protein |
Species Rhodothermus marinus [TaxId:518766] [389057] (1 PDB entry) |
Domain d6wk3a_: 6wk3 A: [389059] Other proteins in same PDB: d6wk3d2 automated match to d4vhba_ complexed with act, cu, hem |
PDB Entry: 6wk3 (more details), 2.45 Å
SCOPe Domain Sequences for d6wk3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wk3a_ a.1.1.0 (A:) automated matches {Rhodothermus marinus [TaxId: 518766]} maptlseqtrqlvrasvpalqkhsvaisatmyrllferypetrslfelpervihklasal layarsidnpsalqaairrmvlsharagvqavhyplvweclrdaikevlgpdatetllqa wkeaydflahllstkeaqvyavlae
Timeline for d6wk3a_:
View in 3D Domains from other chains: (mouse over for more information) d6wk3b_, d6wk3c_, d6wk3d1, d6wk3d2 |