Lineage for d6wk3a_ (6wk3 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689541Species Rhodothermus marinus [TaxId:518766] [389057] (1 PDB entry)
  8. 2689542Domain d6wk3a_: 6wk3 A: [389059]
    Other proteins in same PDB: d6wk3d2
    automated match to d4vhba_
    complexed with act, cu, hem

Details for d6wk3a_

PDB Entry: 6wk3 (more details), 2.45 Å

PDB Description: engineered carbene transferase rmanod q52v, putative nitric oxide dioxygenase from rhodothermus marinus
PDB Compounds: (A:) Nitric oxide dioxygenase

SCOPe Domain Sequences for d6wk3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wk3a_ a.1.1.0 (A:) automated matches {Rhodothermus marinus [TaxId: 518766]}
maptlseqtrqlvrasvpalqkhsvaisatmyrllferypetrslfelpervihklasal
layarsidnpsalqaairrmvlsharagvqavhyplvweclrdaikevlgpdatetllqa
wkeaydflahllstkeaqvyavlae

SCOPe Domain Coordinates for d6wk3a_:

Click to download the PDB-style file with coordinates for d6wk3a_.
(The format of our PDB-style files is described here.)

Timeline for d6wk3a_: