Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (99 species) not a true protein |
Species Novosphingobium aromaticivorans [TaxId:48935] [229374] (5 PDB entries) |
Domain d6wgwb_: 6wgw B: [389050] automated match to d2wm5a_ complexed with cah, cam, hem, so4 |
PDB Entry: 6wgw (more details), 1.73 Å
SCOPe Domain Sequences for d6wgwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wgwb_ a.104.1.0 (B:) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]} khrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpftgghwiatrg tlideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkglnlaeirkle dqirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklgllanemtrps gntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkpmpddralglv sllllggletvvnflgfmmiylsrhpetvaemrreplklqrgveelfrrfavvsdaryvv sdmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaqgphrcagmhl arlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewepq
Timeline for d6wgwb_: