Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (21 species) not a true protein |
Species Escherichia coli [TaxId:83333] [324640] (4 PDB entries) |
Domain d6tj8b2: 6tj8 B:333-527 [389047] Other proteins in same PDB: d6tj8a1, d6tj8a3, d6tj8a4, d6tj8b1, d6tj8b3, d6tj8b4 automated match to d1qgda1 complexed with ca, edo, ndq |
PDB Entry: 6tj8 (more details), 0.92 Å
SCOPe Domain Sequences for d6tj8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tj8b2 c.36.1.0 (B:333-527) automated matches {Escherichia coli [TaxId: 83333]} mpsdfdakakefiaklqanpakiasrkasqnaieafgpllpeflggsadlapsnltlwsg skainedaagnyihygvrefgmtaiangislhggflpytstflmfveyarnavrmaalmk qrqvmvythdsiglgedgpthqpveqvaslrvtpnmstwrpcdqvesavawkygverqdg ptalilsrqnlaqqe
Timeline for d6tj8b2:
View in 3D Domains from other chains: (mouse over for more information) d6tj8a1, d6tj8a2, d6tj8a3, d6tj8a4 |