SCOPe 2.07: Domain d6w0hb1: 6w0h B:1-107

Lineage for d6w0hb1 (6w0h B:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88532] (14 PDB entries)

8. Domain d6w0hb1: 6w0h B:1-107 [389035]
   Other proteins in same PDB: d6w0hb2, d6w0hc_
   automated match to d1r3ja1
   complexed with k

Details for d6w0hb1

PDB Entry: 6w0h, 2.6 Å

PDB Description: closed-gate kcsa soaked in 5mm kcl/5mm bacl2

PDB Compounds: (B:) Fab light chain

SCOPe Domain Sequences for d6w0hb1:

Sequence; same for both SEQRES and ATOM records:

>d6w0hb1 b.1.1.1 (B:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleik

Timeline for d6w0hb1:

• d6w0hb1 is new in SCOPe 2.07-stable
  
• d6w0hb1 appears in the current release, SCOPe 2.08