Lineage for d6ts5a_ (6ts5 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2388211Protein Coagulation factor XI [117237] (1 species)
  7. 2388212Species Human (Homo sapiens) [TaxId:9606] [117238] (58 PDB entries)
    Uniprot P03951 388-624
  8. 3088949Domain d6ts5a_: 6ts5 A: [389011]
    automated match to d3bg8a_
    complexed with dms, nw2, so4

Details for d6ts5a_

PDB Entry: 6ts5 (more details), 1.29 Å

PDB Description: coagulation factor xi protease domain in complex with active site inhibitor
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d6ts5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ts5a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpislpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektq

SCOPe Domain Coordinates for d6ts5a_:

Click to download the PDB-style file with coordinates for d6ts5a_.
(The format of our PDB-style files is described here.)

Timeline for d6ts5a_:

  • d6ts5a_ is new in SCOPe 2.07-stable