Lineage for d1ffko_ (1ffk O:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603029Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 603030Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 603031Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 603032Protein Ribosomal protein L22 [54845] (2 species)
  7. 603033Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (19 PDB entries)
  8. 603038Domain d1ffko_: 1ffk O: [38899]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_
    complexed with cd, k, mo3; mutant

Details for d1ffko_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffko_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffko_ d.55.1.1 (O:) Ribosomal protein L22 {Archaeon Haloarcula marismortui}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOP Domain Coordinates for d1ffko_:

Click to download the PDB-style file with coordinates for d1ffko_.
(The format of our PDB-style files is described here.)

Timeline for d1ffko_: