Lineage for d1bxea_ (1bxe A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32304Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
  4. 32305Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
  5. 32306Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 32307Protein Ribosomal protein L22 [54845] (2 species)
  7. 32310Species Thermus acuaticus, subsp. Thermus thermophilus [54846] (1 PDB entry)
  8. 32311Domain d1bxea_: 1bxe A: [38898]

Details for d1bxea_

PDB Entry: 1bxe (more details), 1.9 Å

PDB Description: ribosomal protein l22 from thermus thermophilus

SCOP Domain Sequences for d1bxea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxea_ d.55.1.1 (A:) Ribosomal protein L22 {Thermus acuaticus, subsp. Thermus thermophilus}
meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
nhdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek

SCOP Domain Coordinates for d1bxea_:

Click to download the PDB-style file with coordinates for d1bxea_.
(The format of our PDB-style files is described here.)

Timeline for d1bxea_: