Lineage for d6rx7b_ (6rx7 B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638013Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2638014Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2638015Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 2638139Protein automated matches [226950] (2 species)
    not a true protein
  7. 2638140Species Human (Homo sapiens) [TaxId:9606] [225942] (12 PDB entries)
  8. 2638146Domain d6rx7b_: 6rx7 B: [388975]
    Other proteins in same PDB: d6rx7c2
    automated match to d1i71a_
    complexed with gol, so4

Details for d6rx7b_

PDB Entry: 6rx7 (more details), 1.63 Å

PDB Description: structure of the kiv type 2 (kiv-2) domain of lipoprotein (a)
PDB Compounds: (B:) apolipoprotein(a)

SCOPe Domain Sequences for d6rx7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rx7b_ g.14.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ecyhgngqsyrgtysttvtgrtcqawssmtphshsrtpeyypnaglimnycrnpdavaap
ycytrdpgvrweycnltqc

SCOPe Domain Coordinates for d6rx7b_:

Click to download the PDB-style file with coordinates for d6rx7b_.
(The format of our PDB-style files is described here.)

Timeline for d6rx7b_: