Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) |
Family d.54.1.1: Enolase N-terminal domain-like [54827] (8 proteins) C-terminal domain is beta/alpha-barrel |
Protein Chlormuconate cycloisomerase [54840] (1 species) |
Species Alcaligenes eutrophus [TaxId:106590] [54841] (2 PDB entries) |
Domain d1chrb2: 1chr B:1-126 [38897] Other proteins in same PDB: d1chra1, d1chrb1 complexed with cl, mn |
PDB Entry: 1chr (more details), 3 Å
SCOP Domain Sequences for d1chrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1chrb2 d.54.1.1 (B:1-126) Chlormuconate cycloisomerase {Alcaligenes eutrophus} mkidaieavivdvptkrpiqmsittvhqqsyvivrvyseglvgvgeggsvggpvwsaeca etikiiverylaphllgtdafnvsgalqtmaravtgnasakaavemalldlkaralgvsi aellgg
Timeline for d1chrb2: