SCOP 1.65: Domain d1chrb2: 1chr B:1-126

Lineage for d1chrb2 (1chr B:1-126)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (8 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Chlormuconate cycloisomerase [54840] (1 species)

7. Species Alcaligenes eutrophus [TaxId:106590] [54841] (2 PDB entries)

8. Domain d1chrb2: 1chr B:1-126 [38897]
   Other proteins in same PDB: d1chra1, d1chrb1
   complexed with cl, mn

Details for d1chrb2

PDB Entry: 1chr, 3 Å

PDB Description: crystal structure of chloromuconate cycloisomerase from alcaligenes eutrophus jmp134 (pjp4) at 3 angstroms resolution

SCOP Domain Sequences for d1chrb2:

Sequence; same for both SEQRES and ATOM records:

>d1chrb2 d.54.1.1 (B:1-126) Chlormuconate cycloisomerase {Alcaligenes eutrophus}
mkidaieavivdvptkrpiqmsittvhqqsyvivrvyseglvgvgeggsvggpvwsaeca
etikiiverylaphllgtdafnvsgalqtmaravtgnasakaavemalldlkaralgvsi
aellgg

Timeline for d1chrb2:

• d1chrb2 first appeared (with stable ids) in SCOP 1.55
  
• d1chrb2 appears in SCOP 1.63
  
• d1chrb2 appears in SCOP 1.67
  
• d1chrb2 last appears in SCOP 1.75