Lineage for d2chr_2 (2chr 1-126)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411574Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 411575Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 411576Family d.54.1.1: Enolase N-terminal domain-like [54827] (9 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 411588Protein Chlormuconate cycloisomerase [54840] (2 species)
  7. 411589Species Alcaligenes eutrophus [TaxId:106590] [54841] (2 PDB entries)
  8. 411590Domain d2chr_2: 2chr 1-126 [38895]
    Other proteins in same PDB: d2chr_1
    complexed with cl, mn

Details for d2chr_2

PDB Entry: 2chr (more details), 3 Å

PDB Description: a re-evaluation of the crystal structure of chloromuconate cycloisomerase
PDB Compounds: ( :)

SCOP Domain Sequences for d2chr_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2chr_2 d.54.1.1 (1-126) Chlormuconate cycloisomerase {Alcaligenes eutrophus}
mkidaieavivdvptkrpiqmsittvhqqsyvivrvyseglvgvgeggsvggpvwsaeca
etikiiverylaphllgtdafnvsgalqtmaravtgnasakaavemalldlkaralgvsi
aellgg

SCOP Domain Coordinates for d2chr_2:

Click to download the PDB-style file with coordinates for d2chr_2.
(The format of our PDB-style files is described here.)

Timeline for d2chr_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2chr_1