SCOPe 2.08: Domain d6pnzc2: 6pnz C:144-293

Lineage for d6pnzc2 (6pnz C:144-293)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (26 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [388929] (1 PDB entry)

8. Domain d6pnzc2: 6pnz C:144-293 [388945]
   automated match to d3r7fa2
   complexed with pal

Details for d6pnzc2

PDB Entry: 6pnz, 2.27 Å

PDB Description: the structure of the aspartate transcarbamoylase trimer from staphylococcus aureus complexed with pala at 2.27 resolution.

PDB Compounds: (C:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d6pnzc2:

Sequence; same for both SEQRES and ATOM records:

>d6pnzc2 c.78.1.0 (C:144-293) automated matches {Staphylococcus aureus [TaxId: 93062]}
yfeglnvlicgdiknsrvarsnyhslkalganvmfnspnawiddsleapyvniddvietv
divmllriqherhglaeetrfaaddyhqkhglnevrynklqehaivmhpapvnrgveiqs
dlveasksrifkqmengvylrmavidellk

Timeline for d6pnzc2:

• d6pnzc2 first appeared in SCOPe 2.07