Lineage for d1mra_2 (1mra 3-132)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503550Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 503551Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 503552Family d.54.1.1: Enolase N-terminal domain-like [54827] (10 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 503657Protein Mandelate racemase [54838] (1 species)
  7. 503658Species Pseudomonas putida [TaxId:303] [54839] (6 PDB entries)
  8. 503664Domain d1mra_2: 1mra 3-132 [38894]
    Other proteins in same PDB: d1mra_1

Details for d1mra_2

PDB Entry: 1mra (more details), 2.1 Å

PDB Description: mandelate racemase mutant d270n co-crystallized with (s)-atrolactate

SCOP Domain Sequences for d1mra_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mra_2 d.54.1.1 (3-132) Mandelate racemase {Pseudomonas putida}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
lvkllganar

SCOP Domain Coordinates for d1mra_2:

Click to download the PDB-style file with coordinates for d1mra_2.
(The format of our PDB-style files is described here.)

Timeline for d1mra_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mra_1