Lineage for d1dtna2 (1dtn A:3-132)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722893Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 722894Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 722895Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 723051Protein Mandelate racemase [54838] (1 species)
  7. 723052Species Pseudomonas putida [TaxId:303] [54839] (6 PDB entries)
  8. 723057Domain d1dtna2: 1dtn A:3-132 [38893]
    Other proteins in same PDB: d1dtna1
    complexed with mg, saa; mutant

Details for d1dtna2

PDB Entry: 1dtn (more details), 2.1 Å

PDB Description: mandelate racemase mutant d270n co-crystallized with (s)-atrolactate
PDB Compounds: (A:) mandelate racemase

SCOP Domain Sequences for d1dtna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dtna2 d.54.1.1 (A:3-132) Mandelate racemase {Pseudomonas putida [TaxId: 303]}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
lvkllganar

SCOP Domain Coordinates for d1dtna2:

Click to download the PDB-style file with coordinates for d1dtna2.
(The format of our PDB-style files is described here.)

Timeline for d1dtna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dtna1