![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
![]() | Protein Mandelate racemase [54838] (3 species) |
![]() | Species Pseudomonas putida [TaxId:303] [54839] (6 PDB entries) |
![]() | Domain d1dtna2: 1dtn A:3-132 [38893] Other proteins in same PDB: d1dtna1 complexed with apg, mg; mutant |
PDB Entry: 1dtn (more details), 2.1 Å
SCOPe Domain Sequences for d1dtna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dtna2 d.54.1.1 (A:3-132) Mandelate racemase {Pseudomonas putida [TaxId: 303]} evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp lvkllganar
Timeline for d1dtna2: