Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein Clp protease, ClpP subunit [52098] (11 species) |
Species Staphylococcus aureus [TaxId:273036] [388880] (3 PDB entries) |
Domain d6l40g_: 6l40 G: [388927] automated match to d3st9f_ complexed with fn3 |
PDB Entry: 6l40 (more details), 2.21 Å
SCOPe Domain Sequences for d6l40g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l40g_ c.14.1.1 (G:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 273036]} diysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggsvtagfaiy dtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggaqgqateiei aanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvpe
Timeline for d6l40g_: