![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
![]() | Protein automated matches [226849] (8 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [272144] (6 PDB entries) |
![]() | Domain d6kuzd5: 6kuz D:731-1022 [388924] Other proteins in same PDB: d6kuza1, d6kuza2, d6kuza3, d6kuza4, d6kuzb1, d6kuzb2, d6kuzb3, d6kuzb4, d6kuzc1, d6kuzc2, d6kuzc3, d6kuzc4, d6kuzd1, d6kuzd2, d6kuzd3, d6kuzd4 automated match to d1jz8a4 complexed with dms, dvl, gol, mg, na |
PDB Entry: 6kuz (more details), 2.83 Å
SCOPe Domain Sequences for d6kuzd5:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kuzd5 b.30.5.0 (D:731-1022) automated matches {Escherichia coli [TaxId: 83333]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq
Timeline for d6kuzd5:
![]() Domains from same chain: (mouse over for more information) d6kuzd1, d6kuzd2, d6kuzd3, d6kuzd4 |