Lineage for d1mdr_2 (1mdr 3-132)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411574Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 411575Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 411576Family d.54.1.1: Enolase N-terminal domain-like [54827] (9 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 411670Protein Mandelate racemase [54838] (1 species)
  7. 411671Species Pseudomonas putida [TaxId:303] [54839] (6 PDB entries)
  8. 411675Domain d1mdr_2: 1mdr 3-132 [38892]
    Other proteins in same PDB: d1mdr_1
    complexed with mg, saa

Details for d1mdr_2

PDB Entry: 1mdr (more details), 2.1 Å

PDB Description: the role of lysine 166 in the mechanism of mandelate racemase from pseudomonas putida: mechanistic and crystallographic evidence for stereospecific alkylation by (r)-alpha-phenylglycidate
PDB Compounds: ( :)

SCOP Domain Sequences for d1mdr_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdr_2 d.54.1.1 (3-132) Mandelate racemase {Pseudomonas putida}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
lvkllganar

SCOP Domain Coordinates for d1mdr_2:

Click to download the PDB-style file with coordinates for d1mdr_2.
(The format of our PDB-style files is described here.)

Timeline for d1mdr_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mdr_1