![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (16 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries) |
![]() | Domain d6kuzb2: 6kuz B:220-333 [388907] Other proteins in same PDB: d6kuza1, d6kuza3, d6kuza5, d6kuzb1, d6kuzb3, d6kuzb5, d6kuzc1, d6kuzc3, d6kuzc5, d6kuzd1, d6kuzd3, d6kuzd5 automated match to d1jz8a1 complexed with dms, dvl, gol, mg, na |
PDB Entry: 6kuz (more details), 2.83 Å
SCOPe Domain Sequences for d6kuzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kuzb2 b.1.4.0 (B:220-333) automated matches {Escherichia coli [TaxId: 83333]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d6kuzb2:
![]() Domains from same chain: (mouse over for more information) d6kuzb1, d6kuzb3, d6kuzb4, d6kuzb5 |